DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and try-4

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:310 Identity:63/310 - (20%)
Similarity:112/310 - (36%) Gaps:92/310 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 VVAFKD-WIYN--TVRNFETKGD-QVVYEECRSNWAEDVLVRLWEVSL---HQNTFSGVLITNRF 311
            |:.|:. ||.|  ::.:|:|..| :|:.|.|.......:....|.||.   ..|...|.:|:...
 Worm    17 VITFEPVWIGNAFSMESFQTIVDNEVLMESCGIQQESKIKNFPWAVSFTVDGVNRLGGSIISPYH 81

  Fly   312 VLTVASAF------------------PNIPLVMKVETKYLKSFDVESI---------HT-----H 344
            ::|.|..|                  ||..:...:  |:|:  |...:         ||     .
 Worm    82 IITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSI--KFLR--DTRKVAYGGTCIRGHTDKYPND 142

  Fly   345 PRFTHSSMDNN---------------------IALLKLAHDVPNSDLVKPICIVPSPKLPRMLTT 388
            ||...|.:.:|                     .|::::...:..|:.|:|||: |.|.:....:.
 Worm   143 PRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICL-PRPNMYYTKSL 206

  Fly   389 LVDETTNDFRGVRNVTLNAINHI------ECAR----RIGKPLKSNQFCVAQPIDF-KVQAPGSI 442
            .|......:  :.|.:...|:.|      :|.|    |:  |..::.|..|..::. ...||.:.
 Worm   207 AVPGWGRSY--IFNESGPLIHEIPMRIDRDCKRPWSDRL--PADADDFICATSMNVSNYSAPRTC 267

  Fly   443 IG------TYRNIGDGNRYYLFGLMSYSKDG-----MVVYTYIQSYLDWI 481
            .|      .||:...| |.:|..:.|:...|     :..:|.:..||:.|
 Worm   268 HGDSGGGLEYRDDNYG-RAFLIAITSFGTRGCPSNMLARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 5/12 (42%)
Tryp_SPc 46..261 CDD:214473 2/7 (29%)
Tryp_SPc 293..484 CDD:304450 52/267 (19%)
Tryp_SPc 293..481 CDD:214473 51/265 (19%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 52/276 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.