DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and try-10

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:280 Identity:59/280 - (21%)
Similarity:110/280 - (39%) Gaps:64/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ICDGTLVHKLFVLTAASCISKDSQLYVLFGM------YNQYRDASQFFNNEQYGVAVALQHSNFR 116
            :|.|.|:....|:|:|.|:.......|...:      .|::.|..|.|.:.    |:|:....|.
 Worm   103 VCGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNKHDDGEQEFRSH----AMAISKKFFN 163

  Fly   117 PNNGVND---IGLLRLYGEVTHYAHIRPICIILD--------HVVKSAPFERFE---------GF 161
            ..:..||   :..|....:|.|    .|:.:.:.        :..::||..:.:         |:
 Worm   164 DASEANDDVAVIFLPQRADVCH----SPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGW 224

  Fly   162 GWQQQGT-EASSQVRQ-TVYLSQKKPFECHRNGQLLPINEGQFC---AGNRDRSFCRSNSGSPLT 221
            |..:..| :.|..||| .|.||.::            |.:.::.   |.......|..:||||:.
 Worm   225 GKTENKTAKYSDSVRQMMVNLSVRR------------IGKRKYLIAKAVTGSSRACMGDSGSPVY 277

  Fly   222 ADFTYGVKNITVQVGLVSY-GSELCSPTSVYTDVVAF-KDWIYNTVRNFETKGDQVVYEECRSNW 284
            . |..|.:   :.||.|:: ||.........::.::| :|:.|..|.::....::||  |....:
 Worm   278 C-FVNGKR---ILVGTVAHIGSFSKMSEQDPSNHISFCRDFEYTFVSDWRESSERVV--EILQKY 336

  Fly   285 AEDVLVRLWEVSLHQNTFSG 304
            .|     |::::..||...|
 Worm   337 GE-----LYQLNEGQNMCFG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 50/238 (21%)
Tryp_SPc 46..261 CDD:214473 49/235 (21%)
Tryp_SPc 293..484 CDD:304450 3/12 (25%)
Tryp_SPc 293..481 CDD:214473 3/12 (25%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 44/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.