DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and F9

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:235 Identity:57/235 - (24%)
Similarity:102/235 - (43%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYN--------QYRDASQFFNNE 102
            ||...:....:..|.|.::::.:::|||.|:....::.|:.|.||        |.|:..:...:.
Mouse   249 PWQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEYNIDKKEDTEQRRNVIRTIPHH 313

  Fly   103 QYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERF-EGF--GWQ 164
            ||...:         |...:||.||.|...:...:::.|||:........  |.:| .|:  ||.
Mouse   314 QYNATI---------NKYSHDIALLELDKPLILNSYVTPICVANREYTNI--FLKFGSGYVSGWG 367

  Fly   165 Q---QGTEASSQVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRD--RSFCRSNSGSPLTADF 224
            :   :|.:||  :.|.:.:.......|.|: ....|....||||.|:  :..|..:||.|...: 
Mouse   368 KVFNKGRQAS--ILQYLRVPLVDRATCLRS-TTFTIYNNMFCAGYREGGKDSCEGDSGGPHVTE- 428

  Fly   225 TYGVKNITVQVGLVSYGSELCS---PTSVYTDVVAFKDWI 261
               |:..:...|::|:|.| |:   ...:||.|..:.:||
Mouse   429 ---VEGTSFLTGIISWGEE-CAMKGKYGIYTKVSRYVNWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 57/235 (24%)
Tryp_SPc 46..261 CDD:214473 55/233 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 55/233 (24%)
Tryp_SPc 237..467 CDD:238113 57/235 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.