DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and F2

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_034298.1 Gene:F2 / 14061 MGIID:88380 Length:618 Species:Mus musculus


Alignment Length:292 Identity:73/292 - (25%)
Similarity:115/292 - (39%) Gaps:48/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLAQLLDKKCHDPKTSENINFNH----------GATETAPWMASIYKNN--QFICDGTLVHKLFV 69
            ||..|.:||.....|.:.:..::          .....|||...:::.:  :.:|..:|:...:|
Mouse   334 GLRPLFEKKSLKDTTEKELLDSYIDGRIVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWV 398

  Fly    70 LTAASCI--------SKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVAL---QHSNFRPNNGVND 123
            ||||.||        ..::.|.|..|.:::.|...   |.|:..:...:   ...|:|.|.. .|
Mouse   399 LTAAHCILYPPWDKNFTENDLLVRIGKHSRTRYER---NVEKISMLEKIYVHPRYNWRENLD-RD 459

  Fly   124 IGLLRLYGEVTHYAHIRPICIILDHVVKS---APFE-RFEGFG-----WQQQGTEASSQVRQTVY 179
            |.||:|...|....:|.|:|:.....|.|   |.:: |..|:|     |.....|....|.|.|.
Mouse   460 IALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVN 524

  Fly   180 LSQKKPFECHRNGQLLPINEGQFCAG-----NRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVS 239
            |...:...|..:.: :.|.:..||||     .:....|..:||.|......:  .|...|:|:||
Mouse   525 LPIVERPVCKASTR-IRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPF--NNRWYQMGIVS 586

  Fly   240 YGSELC---SPTSVYTDVVAFKDWIYNTVRNF 268
            :| |.|   .....||.|...|.||...:..|
Mouse   587 WG-EGCDRKGKYGFYTHVFRLKRWIQKVIDQF 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/247 (26%)
Tryp_SPc 46..261 CDD:214473 63/244 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
F2NP_034298.1 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
KR 213..295 CDD:214527
Thrombin_light 313..360 CDD:286482 6/25 (24%)
Tryp_SPc 360..610 CDD:214473 64/257 (25%)
Tryp_SPc 361..613 CDD:238113 66/259 (25%)
High affinity receptor-binding region which is also known as the TP508 peptide. /evidence=ECO:0000250 548..570 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.