DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CLIPA2

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:252 Identity:64/252 - (25%)
Similarity:113/252 - (44%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYK--NNQFICDGTLVHKLFVLTAASCIS----KDSQLYVLFGMYNQYRDASQFFNNEQY 104
            |||.::::  ..::.|:|.|:....:||.|.|::    :.:.:.|.||.:|...........|..
Mosquito   250 PWMVALFQLPEQRYCCNGALIDPKAILTTAHCVTNCGGRAANIMVRFGEWNMSSTHEMAIPREDI 314

  Fly   105 GVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSA--PFERFE-----GFG 162
            ||....||..:.|:..:|:|.:|.|...|.:.|.|:|:|:      .||  |....|     |:|
Mosquito   315 GVKSVHQHPRYSPSALLNNIAVLELAHPVQYQATIQPVCL------PSANQPLRAMENMIATGWG 373

  Fly   163 WQQQGTEASSQVRQTVYLSQKKPFECH------RNGQLLPINEGQFCA----GNRDRSFCRSNSG 217
            ...:.....:|:.:.:.|.:.:|..|.      |......::....|:    |:::|. |..::|
Mosquito   374 RVMEENAPPTQILKRLDLQRMEPSICREALRRVRRPYPFILDSSFVCSTTNHGDQERP-CDGDAG 437

  Fly   218 SPLTADFTYGVKNITVQVGLVSYG---SELCSPTSVYTDVVAFKDWIYNTVRNFETK 271
            :|:..:.. |..|.....||||:|   .:...|.:|.|.||.|::||...|..|:.|
Mosquito   438 APVVVELP-GTTNRYYLHGLVSWGYGCHQKQIPYTVLTKVVHFREWIDRIVLGFKKK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/243 (25%)
Tryp_SPc 46..261 CDD:214473 59/240 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 61/243 (25%)
Tryp_SPc 244..483 CDD:214473 59/240 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.