DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG43336

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:291 Identity:90/291 - (30%)
Similarity:137/291 - (47%) Gaps:41/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSLALIGLVL----CQGLAQLLDKKC----HDPKTSENINFNHGATETAPWMASIYK-NNQFICD 60
            :::.::||..    ..|..|.||..|    |.|......|....:..::||||.::. :.:|||.
  Fly     1 MNVVVVGLTFFLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICG 65

  Fly    61 GTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYG--------------VAVALQ 111
            |:|:....|||||.|....::|....|.|::          |:|.              |....:
  Fly    66 GSLITNRLVLTAAHCFLDRTELVARLGEYDR----------EEYEMCHDSYCTYRIEAMVERGFR 120

  Fly   112 HSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILD----HVVKSAPFERFEGFGWQQQGTEASS 172
            |.::.|.....||.:||||.:|.:..:||||||::|    ..:.|  .:...|.||.:..:|..|
  Fly   121 HRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDS--LDPLTGTGWGKTESEGDS 183

  Fly   173 QVRQTVYLSQKKPFECHRNGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGL 237
            ...:||.|::|.|..|.|.. .|.:...||||||...:.|..:||.|:.|...||.....||||:
  Fly   184 AKLRTVDLARKHPEVCRRYA-TLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGI 247

  Fly   238 VSYGSELCSPTSVYTDVVAFKDWIYNTVRNF 268
            .|:.:..|...||:|||:::.|||. .|.|:
  Fly   248 ASFTNTQCVMVSVFTDVMSYVDWIL-AVHNY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 78/236 (33%)
Tryp_SPc 46..261 CDD:214473 76/233 (33%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 77/246 (31%)
Tryp_SPc 40..271 CDD:238113 77/243 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463460
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.