DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG43335

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:282 Identity:91/282 - (32%)
Similarity:131/282 - (46%) Gaps:31/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIGLVLCQ-----GLAQLLDKKC--------HDPKTSENINFNHGATETAPWMASIYKNNQFICD 60
            |:.:.:||     |.::||:..|        |..:.   |..:.....:.||||.:|....:.|.
  Fly     7 LVIISVCQWLCRFGESRLLEPNCGIRTMPSFHRTRI---IGGSDAEITSHPWMAYLYNEFHYFCA 68

  Fly    61 GTLVHKLFVLTAASCISKDSQLYVLFGMYNQYR-DASQF-FNNEQYGVAVALQHSNFRPNNGVND 123
            |||:...||||||.||.....|.|..|.....| |.|.. ...|.|.|::|::|..|.|:..:||
  Fly    69 GTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPSIMLND 133

  Fly   124 IGLLRLYGEVTHYAHIRPICIILDHVVKSAPFE--RFEGFGWQQQGTEASSQVRQTVYLSQKKPF 186
            |.::||...|..|.||||||||||..|:....:  .....||      ..:..|...:|.|:.|.
  Fly   134 IAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGW------GLADKRMHPHLLQEAPI 192

  Fly   187 E-CHRN--GQL--LPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCS 246
            . .:||  .:|  :.|.:||.|||:::.:.|..:||.||.....|......||.|:.|:|...|.
  Fly   193 TVMNRNVCSKLYDVAITQGQICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECR 257

  Fly   247 PTSVYTDVVAFKDWIYNTVRNF 268
            ..|:|||:..:..||...|..:
  Fly   258 SPSIYTDLSTYSGWINMVVSQY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 81/226 (36%)
Tryp_SPc 46..261 CDD:214473 79/223 (35%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 80/239 (33%)
Tryp_SPc 42..275 CDD:238113 82/241 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463453
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.