DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CG43124

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:262 Identity:77/262 - (29%)
Similarity:114/262 - (43%) Gaps:53/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLC------QGLAQLLDKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLVHKLFVL 70
            :|||      ||.||.|::.|.|  ..|.||    .:..|||:|.|..:::.||.|.|::.|:||
  Fly     7 IVLCIVLMFYQGSAQTLEEDCVD--HMERIN----GSSYAPWLAEILSDSKVICAGALINNLYVL 65

  Fly    71 TAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTH 135
            |||||..::.:|.|..|  :.|.|.|.    |.:.|..|.......|.|..|::.:.||..||..
  Fly    66 TAASCFKENEKLTVRLG--SGYFDKSY----ENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEF 124

  Fly   136 YAHIRPICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKP---FECHRNGQLLPI 197
            ..||||:||     .||                ..|..:..|..:..:||   :.|..       
  Fly   125 KTHIRPMCI-----TKS----------------PKSLGLATTFEIINEKPKMWYFCKN------- 161

  Fly   198 NEGQFCA---GNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTSVYTDVVAFKD 259
            .:|.||.   |..:..:....:|||.|...:.|.....|:.|::||.... :...||.:|::..:
  Fly   162 IKGLFCKYVFGENEEKWQSKPTGSPWTETISNGPFKGLVRYGILSYRDNK-TYDEVYINVMSHIN 225

  Fly   260 WI 261
            ||
  Fly   226 WI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 63/222 (28%)
Tryp_SPc 46..261 CDD:214473 61/220 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 36/97 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.