DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CLIPB15

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_318957.5 Gene:CLIPB15 / 1279262 VectorBaseID:AGAP009844 Length:364 Species:Anopheles gambiae


Alignment Length:277 Identity:73/277 - (26%)
Similarity:124/277 - (44%) Gaps:31/277 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGLVLCQGLAQLLDKKCHDPKTSENINFNHGATETA-PWMASIYKN---NQFI--CDGTLVHKLF 68
            |.|:.|...:.  ...|...:.::.|.|.......| ||.|.::.|   |:.:  |.|.|:.:.:
Mosquito    84 IPLLCCPKFSN--SPTCGAQQLADRIYFGEETERGAHPWAALLFYNVGRNRTVPKCGGALISERY 146

  Fly    69 VLTAASCISKDSQLYVLFGMYNQYRDAS---------QFFNNEQYGVAVALQHSNFRPNN--GVN 122
            |:|||.|........:|:..:|::..:|         :....|.|.|...:.|..:..:|  ..|
Mosquito   147 VITAAHCTVDKPNWKLLYVRFNEFNTSSADNCTTENDEVICREDYAVESIVPHPEYDMHNISRPN 211

  Fly   123 DIGLLRLYGEVTHYAHIRPICIILDHVVKSAPF--ERFEGFGWQQQGTEASSQVRQTVYLSQKKP 185
            ||.:|||..:||...::||||:..|..|:..|.  |.|...||.:......|..::.|.|...:.
Mosquito   212 DICILRLASDVTFNDYVRPICLPFDPDVQQLPIVDEIFTVTGWGETEDRRPSDTQKHVELPGLEH 276

  Fly   186 FECHRNGQL--LPINEGQFCAGNRDRS-FCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP 247
            ..|:....:  :.:::.|.|.|..:.| .||.:||.||..:    |:.....:|:||:|:..|..
Mosquito   277 EACNSVYAVANVTLSDKQLCIGGLNGSDSCRGDSGGPLMRE----VRGGWFLIGVVSFGARFCGT 337

  Fly   248 TS---VYTDVVAFKDWI 261
            .:   |||:|..:.||:
Mosquito   338 QNLPGVYTNVAKYLDWM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 66/240 (28%)
Tryp_SPc 46..261 CDD:214473 65/238 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CLIPB15XP_318957.5 CLIP 31..90 CDD:197829 2/5 (40%)
Tryp_SPc 110..353 CDD:238113 65/246 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.