DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP008277

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_317194.3 Gene:AgaP_AGAP008277 / 1277708 VectorBaseID:AGAP008277 Length:259 Species:Anopheles gambiae


Alignment Length:282 Identity:66/282 - (23%)
Similarity:107/282 - (37%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALIGLVLCQGLAQLLDKKCHDPKTSENI--NFNHGATETAPWMASIYKNNQFICDGTLVHKLFV 69
            ||:|.|.:...|      |..|..|:..:  .|..| .||.|:..:|:...:.:|.|:::...:|
Mosquito     9 LAVISLPIGNFL------KPDDNNTANMVVGGFQVG-IETVPYQVAIFYAGELLCGGSIIGLHWV 66

  Fly    70 LTAASCISK--DSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGE 132
            ||:..|:|.  .|...::.|:.|...|..:....:....||......:       ||.|:||...
Mosquito    67 LTSYHCVSTRIPSDYGIVVGVTNPEADGRRIHVEDFIFPAVTESDKTY-------DIALVRLNQS 124

  Fly   133 VTHYAHIR--PICIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLL 195
            :.:...::  |:..:.|.:....| ....|||:.|.|   .|:.:..:...|..|::..:.....
Mosquito   125 LVYSEAVQCIPLLSVHDAIGPGKP-AYISGFGFTQDG---GSETQLKIATIQVLPWQTCQEAYPT 185

  Fly   196 PINEGQFCAGNRDRSF-------------CRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP 247
            .:.:...|||     |             |:.:||.||..|        ....|:|.||.....|
Mosquito   186 LMRKYLLCAG-----FMLCAGILAGGVDSCQGDSGGPLVLD--------NQLAGVVFYGIGCGEP 237

  Fly   248 T--SVYTDVVAFKDWIYNTVRN 267
            .  ..|..|..|.|||...|.|
Mosquito   238 NHPGAYISVPWFYDWIVGIVSN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 52/236 (22%)
Tryp_SPc 46..261 CDD:214473 50/233 (21%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP008277XP_317194.3 Tryp_SPc 31..253 CDD:214473 54/246 (22%)
Tryp_SPc 31..253 CDD:238113 54/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.