DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP005706

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_315714.4 Gene:AgaP_AGAP005706 / 1276374 VectorBaseID:AGAP005706 Length:295 Species:Anopheles gambiae


Alignment Length:287 Identity:72/287 - (25%)
Similarity:101/287 - (35%) Gaps:84/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QGLAQLLDKKCHDPKTSENINFNHGATETA-PWMASIY---KNNQFICDGTLVHKLFVLTAASCI 76
            |||..|.|    |...|..|.....|:.|. ||.|.:.   .:....|.|.|:.:..|||||.||
Mosquito    42 QGLPPLTD----DEVRSARIADGQIASPTQFPWAAGVLISGSSAHSFCSGVLISRRHVLTAAVCI 102

  Fly    77 SKDSQLYVLFGMYNQYRDASQFFNNEQY-GVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIR 140
            |..:.|.||.|       ||...:.|:: ||:..|.|.|:......:||.:|.|       ||..
Mosquito   103 SGSNTLTVLLG-------ASDMKSVEEFIGVSNILSHPNYSSFFNRDDIAILTL-------AHEA 153

  Fly   141 PICIILDHVV---KSAPFERFEGF-----GWQQQGTEASSQVRQTVYLSQKKPFECHRNGQLLPI 197
            ||...:..|.   :|.....|..:     ||...|                     .|:.:.:||
Mosquito   154 PIRDTIQPVALPRRSQIGNDFNSWAATTAGWGNSG---------------------RRDNEPIPI 197

  Fly   198 NEGQF-----------------------CAGNRDRSFCRSNSGSPLTA-----DFTYGVKNITVQ 234
            ...||                       |....:...|..:.|.|:|.     .|..|:.:....
Mosquito   198 MNLQFATDAVTSNFRCGLSHTFIRGTHICTATDNGGPCNGDEGGPVTVTESGRTFLIGIHSFHFS 262

  Fly   235 VGLVSYGSELCSPTSVYTDVVAFKDWI 261
             ||  :|.:...| ||:|.:..:.|||
Mosquito   263 -GL--FGCDRGRP-SVHTRITEYLDWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/256 (24%)
Tryp_SPc 46..261 CDD:214473 60/254 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP005706XP_315714.4 Tryp_SPc 56..285 CDD:214473 63/267 (24%)
Tryp_SPc 57..288 CDD:238113 65/268 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.