DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP005670

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_315687.1 Gene:AgaP_AGAP005670 / 1276350 VectorBaseID:AGAP005670 Length:300 Species:Anopheles gambiae


Alignment Length:218 Identity:55/218 - (25%)
Similarity:89/218 - (40%) Gaps:23/218 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ICDGTLVHKLFVLTAASCISKDSQLY-----VLFGMYNQ-YRDASQFFNNEQYGVAVALQHSNFR 116
            :|.|:::...::||||.|:...:...     .:.|.:|: ..:.||  ...::.....::|..:.
Mosquito    82 LCGGSVLTNNYILTAAHCVVSGATTLARGGTAIMGAHNRNVNEPSQ--QRIRFSTGGIIRHPQYT 144

  Fly   117 PNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERF----EGFGWQQQGTEASSQVRQT 177
            ..|..|||.::||...:.....::|  ..|.....:..|..|    .|||....|:.|:|.|.:.
Mosquito   145 TTNIRNDIAVVRLDAPIVFNTRVQP--ARLPARSDTRQFGGFTGTVSGFGRVSDGSTATSAVVRF 207

  Fly   178 VYLSQKKPFECHRNGQLLPINEGQFC-AGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYG 241
            .........:|........|.....| :|...||.|..:||.||...     ...::|:|:||:|
Mosquito   208 TSNPVMTNADCIARWNTALIQPQNVCLSGEGGRSACNGDSGGPLAVQ-----DGGSLQIGIVSFG 267

  Fly   242 SE-LCS--PTSVYTDVVAFKDWI 261
            |. .||  ..|||..|..|..||
Mosquito   268 SAGGCSIGMPSVYARVSFFLSWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 55/218 (25%)
Tryp_SPc 46..261 CDD:214473 53/216 (25%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP005670XP_315687.1 Tryp_SPc 54..290 CDD:214473 53/216 (25%)
Tryp_SPc 55..293 CDD:238113 55/218 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.