DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:239 Identity:54/239 - (22%)
Similarity:93/239 - (38%) Gaps:49/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASI-YKNNQ----FICDGTLVHKLFVLTAASCISKDSQLY---VLFGMYNQYRDASQFFNNE 102
            |:.|:: :|...    :.|.|:|:..:::||.|:|::.:|..|   :|..::|...:..|..|..
Mosquito    51 PYHAALRFKTKSSTKVYTCAGSLITPVYILTTAACVNHNSVEYAFAILGSLFNGNTEWEQHINIT 115

  Fly   103 QYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQG 167
            ..|:.:....|.:    |.|||..:.:....|...:::|  |.|..:..:..:|..||.......
Mosquito   116 MNGIRIHPPSSMY----GHNDIATIHMDHPATLNEYVQP--IRLPRLSDTRTYEMMEGTATSALN 174

  Fly   168 TEASSQVRQTVYLSQKKPFECHRNGQ-LLPINEGQFCAGNR-DRSFCRSNSGSPLTAD-----FT 225
            .:....:|..|..:.    :||...| |..|:....|.... ..|.|...:||.||.:     ..
Mosquito   175 GDGLRYLRNQVMSNA----DCHEAIQPLYNISSQHICTDTYIGGSLCGRTTGSALTVEDENGRML 235

  Fly   226 YGVKNITVQVGL--------VSYGSELCSPTSVYTDVVAFKDWI 261
            .||.|:.|...|        |||                |::||
Mosquito   236 VGVGNLIVLCDLHYPIRHIRVSY----------------FREWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 54/239 (23%)
Tryp_SPc 46..261 CDD:214473 52/237 (22%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 54/239 (23%)
Tryp_SPc 42..263 CDD:214473 52/237 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.