DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:323 Identity:72/323 - (22%)
Similarity:122/323 - (37%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRVLSLALIGLV-LCQGLAQL---------------------------LDKKCHDPKTSEN--- 34
            |...:||.::||: |..|::.|                           |......|..::|   
Mosquito     1 MKFAISLTVVGLLALLHGVSPLPTISSSSYGIDWSQVRPIEEFDHIKAHLPINLRTPIATQNAPN 65

  Fly    35 ---INFNHGATETAPWMASIYKNNQF-----ICDGTLVHKLFVLTAASCI--SKDSQLYV----- 84
               :|.........|:..::.  .||     :|..:::.:.:|||||.|:  ..|:...|     
Mosquito    66 RRIVNGQEARPGQFPYQVALL--GQFNAGVGLCGASIITQRYVLTAAHCVYTGVDASAPVANGTA 128

  Fly    85 LFGMYNQY--RDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILD 147
            :.|.:|:.  ..:.|.......||   :.|..:...:..|||.::||...:.:...|:||     
Mosquito   129 ILGAHNRMIEEPSQQRITFSSSGV---IGHPGYDLFDVRNDIAVVRLDELIVYTDRIQPI----- 185

  Fly   148 HVVKSAPFERF-------EGFGWQQQGTEASSQVRQTVYLSQKKPFECHR--NGQLLPINEGQFC 203
            .:...:....|       .|:|.......|.|.|...|........:|..  :|....|.....|
Mosquito   186 RLPSRSDTRTFAGLMGTVSGYGIYSTANPALSDVLNYVLNPVMTNADCRAGWSGLEWLIEAQNIC 250

  Fly   204 -AGNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSEL-CS---PTSVYTDVVAFKDWI 261
             :|:..|:.|.|:||.|||...:    ..::|||:||:||.: |.   || |:..|..:.:||
Mosquito   251 QSGDGGRAACNSDSGGPLTVQDS----GESLQVGVVSFGSSVGCDNGVPT-VFARVTYYLEWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 60/244 (25%)
Tryp_SPc 46..261 CDD:214473 58/242 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 59/255 (23%)
Tryp_SPc 68..311 CDD:238113 61/256 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.