DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CLIPB7

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_307910.4 Gene:CLIPB7 / 1269288 VectorBaseID:AGAP002270 Length:401 Species:Anopheles gambiae


Alignment Length:263 Identity:65/263 - (24%)
Similarity:101/263 - (38%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYK-----NNQFICDGTLVHKLFVLTAASCISKDSQLY----VLFGMYNQYRDASQFFNN 101
            ||...|..     .::..|.|:|:...:|||||.||....:.:    |..|..|...|..  .::
Mosquito   152 PWNVLIQHRTKDGEHRCHCGGSLISDRYVLTAARCIMGIKKTWTIVSVRVGELNLQTDPD--CDD 214

  Fly   102 EQYGVA--------VALQH----SNFRPNNG---VNDIGLLRLYGEVTHYAHIRPICIILDHVVK 151
            ...||.        :.::.    ||:.....   ..||.||||...|.....:.|||:.|:    
Mosquito   215 STAGVTECASPVEDIPIEKITVPSNYTGTGSPAVKQDIALLRLARRVEFSESVAPICLPLN---- 275

  Fly   152 SAPFERFEGFGWQQQGTEASSQVRQTV-----------YLSQKKPFE-CHRNGQLLPINEGQFCA 204
               ...:.|:..:|.|:...|...:|.           |:|.....| |........|:..|.||
Mosquito   276 ---TSNWVGYSTEQDGSFYESGWGKTPDAAAGGDNKWNYVSVGVAREVCRDRYPHASIDGEQICA 337

  Fly   205 GNR-DRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSE--LCSPTSVYTDVVAFKDWIYNTVR 266
            ..| :::.||.::|.||.  :..|.......:|:.|:..:  :....:|||:|..|.|||   |.
Mosquito   338 MPRSEQNTCRGDTGGPLM--YQSGTDGAWYLMGVGSFRKQCAIVGEPAVYTNVATFTDWI---VE 397

  Fly   267 NFE 269
            |.|
Mosquito   398 NLE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 62/256 (24%)
Tryp_SPc 46..261 CDD:214473 60/253 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CLIPB7XP_307910.4 CLIP 31..85 CDD:288855
Tryp_SPc 151..398 CDD:238113 63/259 (24%)
Tryp_SPc 151..395 CDD:214473 60/253 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.