DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and CLIPB4

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_307755.1 Gene:CLIPB4 / 1269159 VectorBaseID:AGAP003250 Length:360 Species:Anopheles gambiae


Alignment Length:300 Identity:73/300 - (24%)
Similarity:124/300 - (41%) Gaps:66/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLCQGL---------------AQLLDKKCHDPKTSENINFNHGATETAPWMASI-YKNNQ---- 56
            ||.|.|:               .||.|:......|.         .:..||.|.| |:...    
Mosquito    80 LVCCAGVRSKGKTSLPESPNCGVQLTDRVIGGQPTK---------IDEFPWTALIEYEKPNGRFG 135

  Fly    57 FICDGTLVHKLFVLTAASCISKDSQLY----VLFGMYNQ----------YRDASQFFNNEQYGVA 107
            |.|.|:::::.::||||.||:...:.:    |..|.::.          |.||....:.|:    
Mosquito   136 FHCGGSVINERYILTAAHCITSIPRGWKVHRVRLGEWDLSSTTDQEDDFYADAPIDLDIEK---- 196

  Fly   108 VALQHS--NFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGF--GWQQQGT 168
             .:.|.  |.:..:..|||.|:|...|:.:.:.|..||:.|.:.:::........:  ||.:..|
Mosquito   197 -IIVHPGYNLQDKSHHNDIALIRFNREINYSSTISAICLPLSNSLRNRKHAGLSSYAAGWGKTET 260

  Fly   169 EASSQVRQTVYLSQKKPFEC----HRNGQLLPINEGQFCAGN-RDRSFCRSNSGSPLTADFTYGV 228
            .::||.:..|.|:.....:|    .|||  :.::..|.|||. |.:..|..:||.||...    :
Mosquito   261 ASASQKKLKVELTVVDVKDCSPAYQRNG--ISLDSTQMCAGGIRGKDTCSGDSGGPLMRQ----M 319

  Fly   229 KNITVQVGLVSYGSELCSP---TSVYTDVVAFKDWIYNTV 265
            ......:|:||:|.:.|..   ..|||:|..:.|||.:.:
Mosquito   320 SGSWYLIGVVSFGPQKCGAPGVPGVYTNVAEYVDWIKDNI 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 65/248 (26%)
Tryp_SPc 46..261 CDD:214473 63/245 (26%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
CLIPB4XP_307755.1 CLIP 31..83 CDD:371857 2/2 (100%)
Tryp_SPc 108..358 CDD:238113 66/269 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.