DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and AgaP_AGAP013487

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_003436426.1 Gene:AgaP_AGAP013487 / 11176153 VectorBaseID:AGAP013487 Length:308 Species:Anopheles gambiae


Alignment Length:251 Identity:68/251 - (27%)
Similarity:110/251 - (43%) Gaps:42/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQ-----FICDGTLVHKLFVLTAASCIS---KDSQLY-VLFGMY---------NQY 92
            ||.|.|.....     |.|.|:|::..:::|||.||.   :|.::. |..|.:         |::
Mosquito    68 PWTALIEFQKPDGSFGFHCGGSLINDRYIVTAAHCIKSIPRDWKVQRVRLGEWDLTSANDCQNEF 132

  Fly    93 -RDASQFFNNEQYGVAVALQHSNF--RPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAP 154
             .||....:.||..|     |:.:  :..:..|||.|:|....|.:...:||||:.|...:::..
Mosquito   133 CSDAPIDLDIEQIVV-----HTGYDTKDKSNANDIALIRFTRPVNYSQTVRPICLPLSSSLRNRS 192

  Fly   155 FERFEGF--GWQQQGTEASSQVRQTVYLSQKKPFEC----HRNGQLLPINEGQFCAGN-RDRSFC 212
            .:....:  ||::..:..:|:.:..|.:..|...||    .|||.||  .:...|||. |.:..|
Mosquito   193 HDGLISYEVGWRKTNSATASEKKLKVEVEIKSLQECAPIYERNGILL--KQTHMCAGGVRSKDTC 255

  Fly   213 RSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSP---TSVYTDVVAFKDWIYNTV 265
            ..|||.||....|    .....:|:.|:|...|..   ..|||:|..:.|||.:.:
Mosquito   256 SGNSGGPLMRQMT----GSWYLIGVNSFGPRKCGTFGVPDVYTNVAEYVDWIKDNI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 68/248 (27%)
Tryp_SPc 46..261 CDD:214473 66/245 (27%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
AgaP_AGAP013487XP_003436426.1 Tryp_SPc 55..303 CDD:214473 66/245 (27%)
Tryp_SPc 59..306 CDD:238113 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.