DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and KLK11

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:330 Identity:80/330 - (24%)
Similarity:130/330 - (39%) Gaps:122/330 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RVLSLALIGLV--LCQGLAQLL---DKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGT 62
            |:|.|.|:.|.  |..|..:::   :.|.|                :.||.|::::..:.:|..|
Human    34 RILQLILLALATGLVGGETRIIKGFECKPH----------------SQPWQAALFEKTRLLCGAT 82

  Fly    63 LVHKLFVLTAASC------------ISKD-----------SQLYVLFGMYN--------QYRDAS 96
            |:...::||||.|            :|.|           |:..|..|.:|        |.|.|:
Human    83 LIAPRWLLTAAHCLKPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTAT 147

  Fly    97 QFFNNEQYGVAVALQHSNFRPN-NGVNDIGLLRLYGEVTHYAHIRPI------------CIILDH 148
            :.|.:..:        :|..|| :..|||.|:::...|:....:||:            |:|   
Human   148 ESFPHPGF--------NNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLI--- 201

  Fly   149 VVKSAPFERFEGFGWQQQGTEASSQVRQ---------TVYLSQKKPFECHRNGQLLPINEGQFCA 204
                        .||   |:.:|.|:|.         |:...||    | .|.....|.:...||
Human   202 ------------SGW---GSTSSPQLRLPHTLRCANITIIEHQK----C-ENAYPGNITDTMVCA 246

  Fly   205 ----GNRDRSFCRSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPT---SVYTDVVAFKDWIY 262
                |.:|.  |:.:||.||       |.|.::| |::|:|.:.|:.|   .|||.|..:.|||.
Human   247 SVQEGGKDS--CQGDSGGPL-------VCNQSLQ-GIISWGQDPCAITRKPGVYTKVCKYVDWIQ 301

  Fly   263 NTVRN 267
            .|::|
Human   302 ETMKN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 69/277 (25%)
Tryp_SPc 46..261 CDD:214473 67/274 (24%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 69/303 (23%)
Tryp_SPc 54..303 CDD:238113 71/305 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.