DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and MASP2

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:263 Identity:63/263 - (23%)
Similarity:99/263 - (37%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PWMASIYKNNQFICDGTLVHKLFVLTAASCISKDSQLYVLFGMYNQYRDASQF------------ 98
            ||...|....  ...|.|::..:|||||..:            |.|..|||..            
Human   457 PWQVLILGGT--TAAGALLYDNWVLTAAHAV------------YEQKHDASALDIRMGTLKRLSP 507

  Fly    99 FNNEQYGVAVALQHSNFRPNNGV-NDIGLLRLYGEVTHYAHIRPICI---ILDHVVKSAPFERFE 159
            ...:.:..||.: |..:..:.|. |||.|::|..:|...::|.|||:   ..:..:::.......
Human   508 HYTQAWSEAVFI-HEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTAS 571

  Fly   160 GFGWQQQGTEASSQVRQTVYLS-------------QKKPFECHRNGQLLPINEGQFCAG--NRDR 209
            |:|..|:|..|    |..:|:.             :|.|:.   .|.   :.....|||  :..:
Human   572 GWGLTQRGFLA----RNLMYVDIPIVDHQKCTAAYEKPPYP---RGS---VTANMLCAGLESGGK 626

  Fly   210 SFCRSNSGSPL------TADFTYGVKNITVQVGLVSYGSELCSPT---SVYTDVVAFKDWIYNTV 265
            ..||.:||..|      |..:..|        |:||:||..|...   .|||.|:.:..||.|.:
Human   627 DSCRGDSGGALVFLDSETERWFVG--------GIVSWGSMNCGEAGQYGVYTKVINYIPWIENII 683

  Fly   266 RNF 268
            .:|
Human   684 SDF 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 61/257 (24%)
Tryp_SPc 46..261 CDD:214473 59/254 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512
Tryp_SPc 444..679 CDD:214473 59/254 (23%)
Tryp_SPc 445..682 CDD:238113 61/257 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.