DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33465 and LOC103908930

DIOPT Version :9

Sequence 1:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:291 Identity:66/291 - (22%)
Similarity:116/291 - (39%) Gaps:73/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRVLSLALIGLVLCQGLAQLL-DKKCHDPKTSENINFNHGATETAPWMASIYKNNQFICDGTLV 64
            |..|:...|:..|.|..:.::: ..:|  |..|:            ||...|..:.|..|..:|:
Zfish     1 MKTVVFALLVVNVACSPVDKIIGGYEC--PPNSQ------------PWQIYITNDGQRWCGASLI 51

  Fly    65 HKLFVLTAASCISKDSQLYVLFGMYN--QYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLL 127
            ::.:.::||.|....:.|.|..|.:|  ......|....|:     ...|..|:..:..|||.|:
Zfish    52 NESWAVSAAHCNIGANLLTVYLGKHNIDVVEKTEQRIRTEK-----VFPHPEFKFPSEDNDIMLI 111

  Fly   128 RLYGEVTHYAHIRPI------------CIILDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYL 180
            :|........:::||            |::             .|:|:.:.|..:   |.|.:.|
Zfish   112 KLKDPAVFNQYVQPIPLATSCSSEGEQCLV-------------SGWGYTEVGLPS---VLQCLDL 160

  Fly   181 SQKKPFECHRNGQLLPINEGQF-----CAGNRD--RSFCRSNSGSPLTADFTYGVKNITVQVGLV 238
            :.:...||.|      :.:.:|     |||..:  :..|..:||.||       |.|..:: |:|
Zfish   161 AVQSRQECER------VYKDKFTQNMLCAGFMEGGKGVCHGDSGGPL-------VCNGELR-GVV 211

  Fly   239 SYGSELCSP--TSVYTDVVAFKDWIYNTVRN 267
            |:|:....|  .:||.:|..:.|||..|:.|
Zfish   212 SWGAGCAEPGYPAVYVEVCRYSDWIATTIAN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 56/240 (23%)
Tryp_SPc 46..261 CDD:214473 54/237 (23%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 59/266 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.