DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4HA2

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001136071.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens


Alignment Length:333 Identity:59/333 - (17%)
Similarity:124/333 - (37%) Gaps:51/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSD 330
            :::..::.:|:.|:.||...|.||..|......:.....:...|.....:.||.:|.|:..:.:|
Human    32 DLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTD 96

  Fly   331 WTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTK 395
            |...:..:.:|.....:|:|...:::.||..|.......:.::.:.|.:....|:.|.:.|  ||
Human    97 WPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPG--TK 159

  Fly   396 YISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVP 460
            |                 :.::|:.||..:...:....||..:..|:...:..|::..  :....
Human   160 Y-----------------QAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGE--EATTT 205

  Fly   461 SADLYLKLAEVYVKQQNWTLALETVEFALKSNPRN----------AQLIRMQKRLSY----HILL 511
            .:.:...|:....:..:...|||.....|..:|.:          .||:..::..:.    ...|
Human   206 KSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAEL 270

  Fly   512 GPPKS---------PKLNI-------ENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFID 560
            ..|:.         |:.::       |......|:...|:|.|....|....|:||.|.|..:..
Human   271 ATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDS 335

  Fly   561 PLVILYHE 568
            |.::.|::
Human   336 PHIVRYYD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/122 (20%)
TPR repeat 452..491 CDD:276809 5/38 (13%)
P4HA2NP_001136071.1 P4Ha_N 26..155 CDD:311993 24/122 (20%)
TPR 207..240 6/32 (19%)
P4Hc 346..519 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.