DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4HA2

DIOPT Version :10

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_004190.1 Gene:P4HA2 / 8974 HGNCID:8547 Length:535 Species:Homo sapiens


Alignment Length:333 Identity:59/333 - (17%)
Similarity:124/333 - (37%) Gaps:51/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSD 330
            :::..::.:|:.|:.||...|.||..|......:.....:...|.....:.||.:|.|:..:.:|
Human    32 DLIYAEKELVQSLKEYILVEEAKLSKIKSWANKMEALTSKSAADAEGYLAHPVNAYKLVKRLNTD 96

  Fly   331 WTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTK 395
            |...:..:.:|.....:|:|...:::.||..|.......:.::.:.|.:....|:.|.:.|  ||
Human    97 WPALEDLVLQDSAAGFIANLSVQRQFFPTDEDEIGAAKALMRLQDTYRLDPGTISRGELPG--TK 159

  Fly   396 YISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVP 460
            |                 :.::|:.||..:...:....||..:..|:...:..|::..  :....
Human   160 Y-----------------QAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGE--EATTT 205

  Fly   461 SADLYLKLAEVYVKQQNWTLALETVEFALKSNPRN----------AQLIRMQKRLSY----HILL 511
            .:.:...|:....:..:...|||.....|..:|.:          .||:..::..:.    ...|
Human   206 KSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAEL 270

  Fly   512 GPPKS---------PKLNI-------ENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFID 560
            ..|:.         |:.::       |......|:...|:|.|....|....|:||.|.|..:..
Human   271 ATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDS 335

  Fly   561 PLVILYHE 568
            |.::.|::
Human   336 PHIVRYYD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:462433
P4Ha_N 260..391 CDD:462433 24/124 (19%)
LapB <435..>505 CDD:442196 11/79 (14%)
TPR repeat 452..491 CDD:276809 5/38 (13%)
P4HA2NP_004190.1 P4Ha_N 26..157 CDD:462433 24/124 (19%)
BamD 159..>272 CDD:443281 18/131 (14%)
TPR 207..240 6/32 (19%)
P4Hc 346..519 CDD:214780
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.