DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and AT1G20270

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:130 Identity:23/130 - (17%)
Similarity:49/130 - (37%) Gaps:25/130 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 YLSYSNSENRHSLSKSKVINILKIQENVVKYLENYI---------YALETKLKTIDEALIDLATY 302
            :||....|...||:|..::....:.....|..::.:         ...:..:|||::.:.|. |:
plant    91 FLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRRGRDKIIKTIEKRIADY-TF 154

  Fly   303 HIQFERDKLAIASSPVASYSLIHHM--QSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISE 365
                      |.:.......::|:.  |....|:..|:.|...|:....:.::..||   :|:.|
plant   155 ----------IPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNGGQRMATMLMYL---SDVEE 206

  Fly   366  365
            plant   207  206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 18/117 (15%)
TPR repeat 452..491 CDD:276809
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 23/130 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.