DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4H2

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:160 Identity:37/160 - (23%)
Similarity:60/160 - (37%) Gaps:50/160 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 NGVILGTQTKYISS---ALKLEYLYMEIICNRHLMSL------RDCVALSDH-SMEMKDYNKSKE 440
            :.:|..::.|.:||   |...|....::.|: ||:||      |..||.:|: ..::.|...|. 
plant    30 SSIINPSKVKQVSSKPRAFVYEGFLTDLECD-HLISLAKENLQRSAVADNDNGESQVSDVRTSS- 92

  Fly   441 WLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLIRMQKRL 505
              ...||..:     ||||         :.:..|...||       |..|.|..:.|::|.:...
plant    93 --GTFISKGK-----DPIV---------SGIEDKLSTWT-------FLPKENGEDLQVLRYEHGQ 134

  Fly   506 SY-------HILLGPPKSPKLNIENNDYRL 528
            .|       |        .|:||....:|:
plant   135 KYDAHFDYFH--------DKVNIARGGHRI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 0/2 (0%)
TPR repeat 452..491 CDD:276809 8/38 (21%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 31/135 (23%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.