powered by:
Protein Alignment CG34041 and AT-P4H-1
DIOPT Version :9
Sequence 1: | NP_001034077.5 |
Gene: | CG34041 / 3885583 |
FlyBaseID: | FBgn0054041 |
Length: | 568 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_181836.1 |
Gene: | AT-P4H-1 / 818910 |
AraportID: | AT2G43080 |
Length: | 283 |
Species: | Arabidopsis thaliana |
Alignment Length: | 41 |
Identity: | 12/41 - (29%) |
Similarity: | 23/41 - (56%) |
Gaps: | 1/41 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 LRGYSEDLQDHISTLNRYIDDRKSELDKVGK-DPEVYLGNP 86
|||.......::..::|:.:|:.:||.::|. .|||...:|
plant 44 LRGLRGQNTRYLRDVSRWANDKDAELLRIGNVKPEVVSWSP 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10869 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.