DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4H13

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:236 Identity:42/236 - (17%)
Similarity:97/236 - (41%) Gaps:50/236 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TSVMWSALGFSPLLAVLILPKWASSTKMKAYLDL-DTRLKTQL----RGYSEDLQDHISTLNRYI 65
            :::.:..|.::|  .|..||.:|:..:.:|.:|: ..:||...    :|.:.:...:..:|:::.
plant    64 SNIPFHGLSWNP--RVFYLPNFATKQQCEAVIDMAKPKLKPSTLALRKGETAETTQNYRSLHQHT 126

  Fly    66 DDRKSEL-----DKVG---KDPEVYLGNPLNSFSLLHH-------LHFDWPAWRKLMEKPLATEY 115
            |:.:|.:     :|:.   :.|:.|    ..||::|.:       .|:|  |:......||.::.
plant   127 DEDESGVLAAIEEKIALATRFPKDY----YESFNILRYQLGQKYDSHYD--AFHSAEYGPLISQR 185

  Fly   116 ITEIQEMWSEMPTKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQIALHAYDKKNYTEAENWLNI 180
            :.......|.:....|.....:..::.:     |.:::.....|::      |....:|..:.|:
plant   186 VVTFLLFLSSVEEGGETMFPFENGRNMN-----GRYDYEKCVGLKV------KPRQGDAIFFYNL 239

  Fly   181 TLNGYKNLSLQEKDLYEVLSPVIMVYDETNGAAMIAKSYIR 221
            ..||    ::.:..|:. ..|||      .|...:|..:||
plant   240 FPNG----TIDQTSLHG-SCPVI------KGEKWVATKWIR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528 21/128 (16%)
P4Ha_N 260..389 CDD:285528
TPR repeat 452..491 CDD:276809
P4H13NP_850038.1 TatC <4..>40 CDD:294353
P4Hc 85..269 CDD:214780 34/211 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.