DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and p4htmb

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:210 Identity:38/210 - (18%)
Similarity:68/210 - (32%) Gaps:65/210 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EDLQDHISTLNRYIDDRKSELDKVGKDPEVYLGNPLNSFSL----LHHLHFD-WPAWRKL----- 106
            :||:..::.|.|.    .|.|        |.|..||.....    .:|.|.| .|.:.:.     
Zfish   304 QDLRKRVTLLTRL----PSSL--------VELSEPLQVVRYEQGGHYHAHHDSGPVYPETACTHT 356

  Fly   107 -----MEKPLATE--------YITEIQEMW-SEMPTKDEYT--------NSIKAAKDFHKNETQG 149
                 ...|..|.        |:..:||.. :..|..|..|        |.:... |..|:..:|
Zfish   357 RLAANTTSPFQTSCRYITVLFYLNNVQEGGETTFPVADNRTYEEASLIQNDVDLL-DTRKHCDKG 420

  Fly   150 NFEFSPLESLQIALHAYDKKNYTEAENWLNITLNGYKNLSLQEKDLYEVLSPVIMVYDETNGAAM 214
            |....|::...:..:.|    .::...|:.            |:|.|.:....::    |.|...
Zfish   421 NLRVKPVKGTAVFWYNY----LSDGRGWVG------------EQDEYSLHGGCVV----TQGTKW 465

  Fly   215 IAKSYIRYFSNHQME 229
            :|.::|....::|.:
Zfish   466 VANNWINVDPDYQRQ 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528 23/117 (20%)
P4Ha_N 260..389 CDD:285528
TPR repeat 452..491 CDD:276809
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234
EFh 204..262 CDD:298682
P4Hc 285..471 CDD:214780 36/199 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.