DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4ha1

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_742059.2 Gene:P4ha1 / 64475 RGDID:621000 Length:534 Species:Rattus norvegicus


Alignment Length:368 Identity:70/368 - (19%)
Similarity:140/368 - (38%) Gaps:67/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 ILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTID------EAL 296
            :|.:|::   |...::......|..::.:::..::::|..|::||.|.|.||:.|.      :.|
  Rat     5 VLMMGIL---LPQCSAHPGFFTSIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRL 66

  Fly   297 IDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKN 361
            ...||      :|.......||.::.|:..:.::|:..:..:.:|.....:::|...::|.|...
  Rat    67 TSTAT------KDPEGFVGHPVNAFKLMKRLNTEWSELENLILKDMSDGFISNLTIQRQYFPNDE 125

  Fly   362 DISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALS 426
            |.......:.::.:.|.:....|:.|.:.|.:                   ::..::..||..|.
  Rat   126 DQVGAAKALFRLQDTYNLDTNTISKGNLPGVK-------------------HKSFLTAEDCFELG 171

  Fly   427 DHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKS 491
            ..:....||..::.|:..|:..||..........|...||..| || :|.:...||...:..|:.
  Rat   172 KVAYTEADYYHTELWMEQALMQLEEGEMSTVDKVSVLDYLSYA-VY-QQGDLDKALLLTKKLLEL 234

  Fly   492 NPR----NAQLIRMQKRLSYHILLG------------PPKSPKLNI----ENNDYRL-------- 528
            :|.    |..|:..:..:|......            .||...:.:    |...|.:        
  Rat   235 DPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQKTTPKKKGIAVDYLPERQKYEMLCRGEGIK 299

  Fly   529 ---RKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
               |:...|:|.|....|....:|||.|.|..:..|.:|.:|:
  Rat   300 MTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 26/134 (19%)
TPR repeat 452..491 CDD:276809 10/38 (26%)
P4ha1NP_742059.2 P4Ha_N 25..112 CDD:400573 18/92 (20%)
TPR 205..238 11/34 (32%)
P4Hc 345..518 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.