DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and p4ha1a

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_009304776.1 Gene:p4ha1a / 562774 ZFINID:ZDB-GENE-040724-91 Length:541 Species:Danio rerio


Alignment Length:369 Identity:75/369 - (20%)
Similarity:146/369 - (39%) Gaps:56/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 MKSACILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTID---E 294
            ::|.|..   |:|..|..|::.:....|...:.::|..::::|..|::||.|.|:||:.:.   |
Zfish     4 VRSVCCF---LLISLLKSSSAHSDFFTSIGHMTDLLFTEKDLVTSLKDYIKAEESKLEQVKQWAE 65

  Fly   295 ALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPT 359
            .|..|....:|   |.......||.::.|:..:.::|...:..:.:|.....:::|...::|.|.
Zfish    66 KLDALTATAVQ---DPEGFLGHPVNAFKLMKRLNTEWGEVEDLVLKDMSDGFISNLTIQRQYFPN 127

  Fly   360 KNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVA 424
            ..|.:.....:.::.:.|.:..|.|::|.:.|..|       .|.|        :..:::.||..
Zfish   128 DEDQNGAAKALLRLQDTYKLDTQTISSGDLPGVNT-------GLPY--------KSTLTVEDCFE 177

  Fly   425 LSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFAL 489
            |...:....||..::.|:..|:..|:........:.:|..||..: || :|.....|||..:..|
Zfish   178 LGKIAYSDADYYHTELWMAQALKQLDEGEESSVEIATALDYLSYS-VY-QQGELERALEYTKRLL 240

  Fly   490 KSNPRNAQLIRMQKRLSYHIL--------LGPPKSPKLNIENNDYRL------------------ 528
            ...|.:.:.:...|...|.:.        ....:..|...|.:|.:.                  
Zfish   241 TVEPEHQRALGNLKYFDYQLAKQKKAEKEQSTKEESKKEQETSDGKKEYLPEKRKYEKLCRGEGL 305

  Fly   529 ----RKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
                |:...|:|.|....|..:..:.|:|.|..:..|.:|.|||
Zfish   306 KMTPRRQKHLFCRYFNGNRHPFYTIGPVKQEDEWDRPRIIRYHE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 28/131 (21%)
TPR repeat 452..491 CDD:276809 10/38 (26%)
p4ha1aXP_009304776.1 P4Ha_N 28..157 CDD:285528 28/131 (21%)
TPR repeat 172..207 CDD:276809 8/34 (24%)
TPR repeat 212..242 CDD:276809 10/31 (32%)
Fis1 218..262 CDD:304536 12/45 (27%)
P4Hc 352..525 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.