DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4HTM

DIOPT Version :10

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:180 Identity:35/180 - (19%)
Similarity:68/180 - (37%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSK----EWLNVAISM 448
            |.|.|...:....|.|:.|..||   ...::..:| .|..|..:||...:|:    |....|:|.
Human   125 VQLVTDRDHFIRTLSLKPLLFEI---PGFLTDEEC-RLIIHLAQMKGLQRSQILPTEEYEEAMST 185

  Fly   449 LESSA--YWDPIVPSADLYLKLAEVYVKQQ---NWTLALETVE---FALKSNPRNAQLIRMQKRL 505
            ::.|.  .:..:..:.|.:|:|.||..:.:   .|.:..|:::   .|:|::|....::.:|:  
Human   186 MQVSQLDLFRLLDQNRDGHLQLREVLAQTRLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQE-- 248

  Fly   506 SYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAE 555
                                           |.:..:|.|:..:...|||
Human   249 -------------------------------FSNMDLRDFHKYMRSHKAE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:462433
P4Ha_N 260..391 CDD:462433 1/2 (50%)
LapB <435..>505 CDD:442196 16/81 (20%)
TPR repeat 452..491 CDD:276809 9/46 (20%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:463900 12/92 (13%)
P4Hc 246..519 CDD:214780 7/55 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.