DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4HTM

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:180 Identity:35/180 - (19%)
Similarity:68/180 - (37%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSK----EWLNVAISM 448
            |.|.|...:....|.|:.|..||   ...::..:| .|..|..:||...:|:    |....|:|.
Human   125 VQLVTDRDHFIRTLSLKPLLFEI---PGFLTDEEC-RLIIHLAQMKGLQRSQILPTEEYEEAMST 185

  Fly   449 LESSA--YWDPIVPSADLYLKLAEVYVKQQ---NWTLALETVE---FALKSNPRNAQLIRMQKRL 505
            ::.|.  .:..:..:.|.:|:|.||..:.:   .|.:..|:::   .|:|::|....::.:|:  
Human   186 MQVSQLDLFRLLDQNRDGHLQLREVLAQTRLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQE-- 248

  Fly   506 SYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAE 555
                                           |.:..:|.|:..:...|||
Human   249 -------------------------------FSNMDLRDFHKYMRSHKAE 267

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528