DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG9698

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_651806.2 Gene:CG9698 / 43629 FlyBaseID:FBgn0039784 Length:547 Species:Drosophila melanogaster


Alignment Length:351 Identity:66/351 - (18%)
Similarity:128/351 - (36%) Gaps:79/351 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 HSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDK-------LAIA 314
            |.::|     :...::.:|.:::.::...:.||..:...|       .:||.::       .:..
  Fly    30 HEMTK-----VFGYEQKMVLHMQKFLSDNQDKLDFLKARL-------REFENERNEAREWGPSYF 82

  Fly   315 SSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSI--KKYLPTKNDISEVCHGISKMLNAY 377
            .||:..|.|...:..||...:..:....|:..|..|...  ::.:|.|.::.....|:.::...|
  Fly    83 ESPINKYLLNKRLTVDWQRVENLMATSTGEKPLTRLRKFRNRETMPDKKELEGAIDGLLRLQYVY 147

  Fly   378 LMTAQDIANGVI----LGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKS 438
            .:.|:|:|.|::    .|||                       ::...||.::..::..:....:
  Fly   148 RLKAKDLARGILDGVDYGTQ-----------------------LNSEHCVDIARLALRDQHPRLA 189

  Fly   439 KEWLNVAISMLESSAYWDPIVPSA------------------DLYLKLAEVYVKQQNWTLALETV 485
            ..||..|...|......:.:.|..                  |.|.:|..:....:......||.
  Fly   190 HSWLIEANDRLTGGEKEEQLKPQILALLVQAKKELEDFRGLNDTYQELIGIQSASEEHAKNYETF 254

  Fly   486 EFALKSNPRNAQLIRMQKRLSYHILLGPPKSPKLNIE------NNDYRL--RKNGSLYCFYDTKI 542
            ..||...    .|:...|.:..|..:.....|....:      :..:||  ::...|.|.|.|:.
  Fly   255 LNALSEK----ALLNESKPILEHAPIPEEGEPVGEFQAYSLTCSGHWRLTPKEQRHLRCGYVTET 315

  Fly   543 RTFYSLLAPIKAEVLFIDPLVILYHE 568
            ..|. .:||:|||.||.|||::|||:
  Fly   316 HPFL-WIAPLKAEELFQDPLLVLYHD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/137 (18%)
TPR repeat 452..491 CDD:276809 8/56 (14%)
CG9698NP_651806.2 P4Ha_N 28..159 CDD:285528 25/140 (18%)
P4Hc 345..516 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.