DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG15539

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001036776.1 Gene:CG15539 / 43627 FlyBaseID:FBgn0039782 Length:509 Species:Drosophila melanogaster


Alignment Length:352 Identity:84/352 - (23%)
Similarity:166/352 - (47%) Gaps:51/352 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LSVGLIIVYL-----SYSNS---ENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEA 295
            |.:.|.|:||     |:|..   ||.:::|...:..::..:..::..|:.:..||:.::.|::  
  Fly     4 LLISLAILYLLVLVKSHSKPKILENNYAISIYDMSKLIDYEHYLLNILQKFANALQKRVDTLE-- 66

  Fly   296 LIDLATYHIQ---FERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYL 357
                  |:::   ::|:| .:|..|:..:.:...:.||:.:|..|::|.|....:..:::|...:
  Fly    67 ------YYLEMTDYDREK-NLAEDPIKHFRITRRLHSDYVNWVWFMEEQPWGTLVKDIIAIAPEM 124

  Fly   358 PTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDC 422
            ||..|:.|...|:..:...|.:...::|.||:                  .:|..|..|..:: |
  Fly   125 PTLKDVEEAIRGLRLIQWTYSLPTAEMAKGVL------------------QDIHHNTSLDGMQ-C 170

  Fly   423 VALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPI-----VPSADLYLKLAEVYVKQQNWTLAL 482
            :.::.|.:..||:.::||||.|.:.|.|:....:.|     :|..|.|....|:..:..:..||:
  Fly   171 ITIARHMVNYKDFIRAKEWLMVGLKMYEADEEIEYIYSQLGMPLVDFYELFVEIQDELGSRYLAM 235

  Fly   483 ETVEFALKSNPRNAQLIRMQKRLSYHILLGPPKSPKLNIENNDYR------LRKNGSLYCFYDTK 541
            ..::.|:|:.|....|.|...||..:|.:|...:.|.|.....|:      .|....|||.|.| 
  Fly   236 SELQLAIKNWPEKVSLQRALSRLKMNIRIGKEPAEKKNKSKRVYKKCCSSECRPTAKLYCLYKT- 299

  Fly   542 IRTFYSLLAPIKAEVLFIDPLVILYHE 568
            ..:::..|||:|.|:|.:||.::|:|:
  Fly   300 TSSYFLRLAPLKMELLSLDPYMVLFHD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 25/131 (19%)
TPR repeat 452..491 CDD:276809 8/43 (19%)
CG15539NP_001036776.1 P4Ha_N 33..156 CDD:285528 25/131 (19%)
P4Hc 329..494 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.