DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and PH4alphaEFB

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_733371.1 Gene:PH4alphaEFB / 43620 FlyBaseID:FBgn0039776 Length:550 Species:Drosophila melanogaster


Alignment Length:368 Identity:82/368 - (22%)
Similarity:145/368 - (39%) Gaps:59/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 ILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATY 302
            :|.:|::::....:|.|...:|::.:  .:|:.:..::..||.||...|.||..:...:.:....
  Fly     8 MLLLGILLLVGGPANGEVYTALAEME--ELLETESVLITNLEGYIRVQEDKLNFLKNKMDEYQRE 70

  Fly   303 HIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYL--PTKNDISE 365
            |.....|..|..|:|:.:|.|...:.:||...:..::.|.|.|.|.::...:..|  |:..|::.
  Fly    71 HSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQYRSLLKFPSDEDLNG 135

  Fly   366 VCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSM 430
            ....:.::.:.|.:....:|.|.:.|.|  |.:.                 ||..||..|...|.
  Fly   136 AAVALLRLQDTYQLDTSSVARGKLNGIQ--YSTE-----------------MSSDDCFELGRQSY 181

  Fly   431 EMKDYNKSKEWLNVAIS-MLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPR 494
            ...||..:..|:|.|:: |||...........||:...||....|:.|...||......|:..|.
  Fly   182 VNHDYYHTVLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKEGNIESALTMTNELLQLLPH 246

  Fly   495 ----NAQLIRMQKRLSYHILL-------GPPKSPKLNI-------------ENNDYRLRKNG--- 532
                |......:|.::..:.|       |..:.||.::             |...|.:...|   
  Fly   247 HERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERRAYEMLCRGELK 311

  Fly   533 -------SLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
                   ||.|.|.|. |..:..|.|:|.|.:..||.:::||:
  Fly   312 PSPSDLRSLRCRYVTN-RVPFLRLGPLKLEEVHADPYIVIYHD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 27/130 (21%)
TPR repeat 452..491 CDD:276809 9/38 (24%)
PH4alphaEFBNP_733371.1 P4Ha_N 28..159 CDD:285528 28/132 (21%)
P4Hc 356..529 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462005
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.