DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG11828

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_651648.5 Gene:CG11828 / 43416 FlyBaseID:FBgn0039616 Length:458 Species:Drosophila melanogaster


Alignment Length:325 Identity:69/325 - (21%)
Similarity:132/325 - (40%) Gaps:65/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSD 330
            ::|:|::.::.|:..|...|:.|:.|:.....:..|.......|..:..::|:.|:.|:....:|
  Fly     3 SLLQIEDELIGYMRQYAMELQHKVNTMRTFQEEWMTRRALGPADPTSYVANPLISFPLMRRTYTD 67

  Fly   331 WTHWQLFLQED--PG------KDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANG 387
            ........:|:  ||      ..:|:|:..:        ::.....|:.:....|.|...::|||
  Fly    68 VPKLLELAREEFKPGPFQKFIDYDLSSISDV--------ELETAVTGMLRFQGVYGMDESEMANG 124

  Fly   388 VILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSK---EWLNVAISML 449
            .:.|.|  |.|.                 ||..||:|::.|   :::.:|.|   :|..|||...
  Fly   125 KLHGKQ--YNSR-----------------MSAADCLAVATH---LENVDKGKLACKWFKVAIDQY 167

  Fly   450 ESSAYWDPIVPSADLYLKLAEVYVKQQNWTLAL-----------ETVEFALKSNPRNAQLIRMQK 503
            |...  ||:  :..|....:::|.|.....||:           :::.:|.|.:  |..|.:..|
  Fly   168 EEKL--DPV--NRLLQTGRSQIYEKLGLTLLAMHDLPASQAAFRDSIGWASKED--NTDLAKHLK 226

  Fly   504 RLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
            ....|:.:........|:      |.....|.|.| .:..:.:..:||:|.|.|.|:|.|.|:|:
  Fly   227 DKLAHMFVHVDNCRGKNL------LPSKSYLRCRY-LRDGSPFLRMAPVKLEQLNIEPFVGLFHD 284

  Fly   569  568
              Fly   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/130 (18%)
TPR repeat 452..491 CDD:276809 8/49 (16%)
CG11828NP_651648.5 P4Ha_N 1..126 CDD:285528 24/130 (18%)
P4Hc 287..445 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.