DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG32199

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_730347.1 Gene:CG32199 / 40028 FlyBaseID:FBgn0052199 Length:509 Species:Drosophila melanogaster


Alignment Length:353 Identity:66/353 - (18%)
Similarity:147/353 - (41%) Gaps:79/353 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 HSLSKSKVINILKIQENVVKYLENYIYALETKL---KTIDEAL--IDLATYHIQFERDKLAIASS 316
            :|.|...::.:|:::|::...|:.|:..:::||   |...::|  :.|.|.     .:|....|:
  Fly     3 YSTSVMSMMKLLEMEESLKTNLDIYVQEMQSKLDLIKLYQDSLKRVTLTTL-----EEKEEYVSN 62

  Fly   317 PVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTA 381
            |:.::.::..:..||..|..:::......::..:....|..|..:|:.....|::::...:.:.|
  Fly    63 PLNAFPMLRRLNQDWPKWLRYIKLAIASKKIKEMEVQLKSAPIDDDLKVALKGMTRIEKFHNLHA 127

  Fly   382 QDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAI 446
            :|:..||::|.:                  .|.|| :..|||||.|:......::.|..|..:|:
  Fly   128 EDLTKGVLMGKK------------------LNSHL-TAPDCVALGDYYYNQTQFSGSTHWYRMAL 173

  Fly   447 ----------------------------SMLESSAYWD---PIVPSADLYLKLAEVYVKQQNWTL 480
                                        ::|:.|...|   |.......:.:||:...::.|:..
  Fly   174 RVHTHPRGMIYAKVLGLKRKRIYKKYAKALLKESLNSDKSKPTPTEKSEWNRLAKEVTREDNYDN 238

  Fly   481 ALETVEFALKSNPRNAQLI--RMQKRLSYHILLGPPKSPKLNIE---NNDYRLRKNGSLYCFYDT 540
            ..:.::..|..:.:..|.:  |::::        |.|     :|   ..::..:.:..|.|.|:.
  Fly   239 VKKLIDEYLSGDEKIFQEVAARLKRK--------PTK-----LERGCRGEWPKKSSPELICRYNR 290

  Fly   541 KIRTFYSLLAPIKAEVLFIDPLVILYHE 568
            ....|.. |||:|.|.|.:.|:::|||:
  Fly   291 DTSAFLK-LAPLKLEFLSVQPMILLYHD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/133 (18%)
TPR repeat 452..491 CDD:276809 7/41 (17%)
CG32199NP_730347.1 P4Ha_N 6..135 CDD:285528 24/133 (18%)
P4Hc <369..497 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461714
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.