DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG18749

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001027154.1 Gene:CG18749 / 3771984 FlyBaseID:FBgn0042182 Length:491 Species:Drosophila melanogaster


Alignment Length:347 Identity:73/347 - (21%)
Similarity:165/347 - (47%) Gaps:49/347 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 QMEFIVMKSACILSV-GLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLK 290
            ::.||...|||.::. |.:     .||.:..::.|..:::.:|::::.:|..|:.|:..|:.|..
  Fly     6 KLTFIGFLSACFINCQGFV-----NSNPKKSYAASTMELMKLLEVEDELVDNLKGYVKTLKMKFN 65

  Fly   291 TIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFL----QEDPGKDELASLM 351
            .::.:|||::..:::.:.|..:...:|:.|:.|||.:.:.|..|..:.    ....|..|.|.||
  Fly    66 LMERSLIDMSRENMEMKSDYESYLGNPLNSFRLIHRLHTSWRKWYQYAIKVENNALGHIENARLM 130

  Fly   352 SIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHL 416
              :|.|||.:|:.:.|.||..::..|.:..:::|.|.:.|    |......|             
  Fly   131 --RKMLPTSSDLQQACRGIHDLMYFYDLKPEELAAGNLAG----YSQPGTGL------------- 176

  Fly   417 MSLRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLA 481
             :..||:||.:..::.:..:.::.|.|::::.      :|.|:....::...|.:..|.:..|.|
  Fly   177 -TAYDCLALGEFGVQNQKDDLAEAWYNLSLTR------FDNIIEKYQVHKAWALLLAKNKQLTEA 234

  Fly   482 LETVEFALKSNPRNAQLIRMQKRLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFY 546
            .:..|    :.|..  ::...:.:.:..:|...::....::      :.:..|:|.|:|. .|.:
  Fly   235 FQHFE----NKPEG--IVASNEVIHFEGVLATTQNCTAVVQ------KPSKKLHCRYNTS-TTPF 286

  Fly   547 SLLAPIKAEVLFIDPLVILYHE 568
            :.:||:|.|.|.:||.::::|:
  Fly   287 TRIAPLKMEELGLDPYMVVFHD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 34/132 (26%)
TPR repeat 452..491 CDD:276809 7/38 (18%)
CG18749NP_001027154.1 P4Ha_N 35..166 CDD:285528 34/132 (26%)
P4Hc 314..468 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.