DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4ha2

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001101745.1 Gene:P4ha2 / 360526 RGDID:1309673 Length:535 Species:Rattus norvegicus


Alignment Length:356 Identity:69/356 - (19%)
Similarity:131/356 - (36%) Gaps:63/356 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLA 312
            ||:..:|...|:  ..:.:::..::::|:.|:.||.|.|.||..|......:.....:...|...
  Rat    16 LSWVQAEFFTSI--GHMTDLIYAEKDLVQSLKEYILAEEAKLSKIKSWASKMEALTSKSAADPEG 78

  Fly   313 IASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAY 377
            ..:.||.:|.|:..:.:||......:.:|.....:|:|...:::.||..|.|.....:.::.:.|
  Rat    79 YLAHPVNAYKLVKRLNTDWPALGDLVLQDAAAGFVANLSVQRQFFPTDEDESGAARALMRLQDTY 143

  Fly   378 LMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWL 442
            .:....|:.|.:.|  |||                 :.::|:.||..:...:....||..:..|:
  Rat   144 KLDPDMISRGELPG--TKY-----------------QAMLSVDDCFGMGRSAYNEGDYYHTVLWM 189

  Fly   443 NVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTL-----ALETVEFALKSNPRN------- 495
            ...:..|::.       ..|.:...|...|:....:.|     |:|.....|..:|.:       
  Rat   190 EQVLKQLDAG-------EEATVTKSLVLDYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNL 247

  Fly   496 ---AQLIRMQ--KRLSYHILLGPPKSPKLNIENNDY------------------RLRKNGSLYCF 537
               .:|:..:  |.||.....|......|.....||                  ..|:...|:|.
  Rat   248 RYFERLLEEERGKSLSNQTDAGLASQENLYERPVDYLPERDVYESLCRGEGIKMTPRRQKRLFCR 312

  Fly   538 YDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
            |....|....|:||.|.|..:..|.::.|::
  Rat   313 YHHGNRVPQLLIAPFKEEDEWDSPHIVRYYD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 26/128 (20%)
TPR repeat 452..491 CDD:276809 7/43 (16%)
P4ha2NP_001101745.1 P4Ha_N 27..104 CDD:400573 16/78 (21%)
P4Hc 346..519 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.