DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG31016

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster


Alignment Length:359 Identity:85/359 - (23%)
Similarity:158/359 - (44%) Gaps:54/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 MKSACILSVGLIIVYLS-----YSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTI 292
            |.|..:.:|..|:| ||     |.:.:| :.:|..:.:::|:....::..|::|...|..|:..:
  Fly     1 MSSVVLFAVSFILV-LSWIAEGYRDRQN-YVISVEEKMDLLEKDRELIIVLDSYATELNEKIIML 63

  Fly   293 DEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYL 357
            ...:.:......:.:..:....|:|:.|.||:..|..||...:..|::..|::::|.:..:::.|
  Fly    64 KRIVKEFKQPLEKAKNREEEYLSNPIDSLSLMRQMHEDWEKVEKLLKKPVGQEKIALVEKMREDL 128

  Fly   358 PTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDC 422
            |.:||:.|....:.::|:.|.:..:|::.|.|.|.|  |...                 ||..||
  Fly   129 PVENDLMEANQAMFRILHTYDLEPKDVSAGWIDGVQ--YGGK-----------------MSASDC 174

  Fly   423 VALSDHSMEMKDYNKSKEWLNVAISML--ESSAYWDPI-VPSADLYLKLAEVYVKQQNWTLALET 484
            ..:...|.....|..:.:||:.|..:|  :...|.:.: :..||:.|.||...:...|.::|.:.
  Fly   175 FTMGTFSFMAGSYQIASKWLSAAKDLLVDQPRKYHEVMGITKADVTLLLARSLIASGNVSIATDM 239

  Fly   485 VEFALKSNPRNAQLIRMQKRLSYHILLGPPKSPKLNIEN--NDYRLR--------------KNGS 533
            :       .|:.........|:.|.|...|| |.:|:|:  :|....              |...
  Fly   240 L-------MRDFMFGEAGSALTVHFLRNKPK-PSINLESWESDESFNQLCRSSSRRQMGESKPSR 296

  Fly   534 LYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYH 567
            |:|.|:| |.|.:..|||.:.|.|.:||.||.||
  Fly   297 LHCRYNT-ITTPFLKLAPFRMEELSLDPYVIFYH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 26/128 (20%)
TPR repeat 452..491 CDD:276809 8/39 (21%)
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528 26/128 (20%)
P4Hc 333..508 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461993
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.