DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG31013

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster


Alignment Length:335 Identity:94/335 - (28%)
Similarity:163/335 - (48%) Gaps:34/335 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFERDKLA 312
            |.:...|..||||...::.:|::::.::..||||..|||.||:.|...|:.:...:.:..|:.::
  Fly    19 LGHRPLEKSHSLSLVTMVPLLELEKKLIDNLENYTNALEQKLEIIRSQLLVIRAENEKGRRNAIS 83

  Fly   313 IASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAY 377
            ..|:|:..:|:|..:..||.:|:.::::..|..:|.:..|.|..|||:.|:.:.|.||:::.:.|
  Fly    84 YLSNPLNGFSIIRRLHQDWINWRKYMEQPVGIWQLKAFYSWKDELPTERDLWDACEGIARIQSTY 148

  Fly   378 LMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWL 442
            .:...|..||.|.|.|  |..|                 ||..|.:::..:.......:.:.:||
  Fly   149 DLKVGDFINGNINGKQ--YNDS-----------------MSTADILSVGAYLFMKNRPSDAIQWL 194

  Fly   443 NVAISMLESSAYWDP---IVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLIRMQKR 504
            ......|:......|   .:...|....|||..:|.||::.||..:...||..|.:|:::|:.|:
  Fly   195 QEVPQRLQEELLIQPRHLPIKEVDALRLLAEAQIKDQNYSEALPLLHNCLKLQPHDARVLRLWKK 259

  Fly   505 LSYHILLGPPKSPKLNIEN-----NDYRLRKNG------SLYCFYDTKIRTFYSLLAPIKAEVLF 558
            .:..|...|.:||..|.:.     |.::|..||      .|:|||:.....|.. |||:|.|.:.
  Fly   260 TTDFIENQPDQSPTENKKRNVPIANAFKLSCNGPLESSTRLHCFYNFTTTPFLR-LAPLKTEQIG 323

  Fly   559 IDPLVILYHE 568
            :||.|:||||
  Fly   324 LDPYVVLYHE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 36/128 (28%)
TPR repeat 452..491 CDD:276809 11/41 (27%)
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528 36/128 (28%)
TPR_11 178..248 CDD:290150 15/69 (22%)
TPR repeat 211..246 CDD:276809 10/34 (29%)
P4Hc 336..513 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462013
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.