DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and CG31524

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster


Alignment Length:350 Identity:89/350 - (25%)
Similarity:151/350 - (43%) Gaps:47/350 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LIIVYLSYS-----NSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATY 302
            ::|.:||.|     .::.|.:.|...:.::|.:::::|..||.|...|..|..||...:..:.. 
  Fly     9 VVIFFLSLSMGQIEATQPRFARSVVNMDDLLNMEDDLVSKLEGYAEKLSYKANTIRWGIQQMRE- 72

  Fly   303 HIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVC 367
              |.::.|...:......||.|.|||:||..|:.:|.:...:|||.........:|.:.|:.:..
  Fly    73 --QLDKSKKEQSFDLFNRYSFIRHMQADWLMWKQYLDKPVIRDELNYKQMDNLRMPQELDLFDAS 135

  Fly   368 HGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEM 432
            ..|.:|...|.|.:.|||.|.:.|.|  |.|.                 :|..||:|:..|.|..
  Fly   136 EAIRRMQATYAMLSNDIAEGFLDGVQ--YTSK-----------------LSPIDCLAMGRHLMNQ 181

  Fly   433 KDYNKSKEWLNVAISMLESSAYWDPIV-----PSADLYLKLAEVYVKQQNWTLALETVEFALKSN 492
            ..:..:::|:...|...:.......::     ..|:|:..|.:|..:::|...||:..:.|||.:
  Fly   182 SRWTIAEQWILAGIKAQDRKGPQTEMILLRGPTKAELFRTLGKVRFERRNEEGALKAYQAALKHS 246

  Fly   493 PRNAQLIRMQKRLSYHILLGPPKSPKLNIENNDYR--------------LRKNGSLYCFYDTKIR 543
            |.:.::.:..:.|...:|...|..|.....|:|..              .||...|||.|:....
  Fly   247 PHDLEIFQEYQNLKRRVLTLSPSEPIREEPNDDIEEMELPPCCSGRCEGPRKLNRLYCVYNCVTA 311

  Fly   544 TFYSLLAPIKAEVLFIDPLVILYHE 568
            .|.. |||||.|:|.:||.|||.|:
  Fly   312 PFLR-LAPIKTEILSVDPFVILLHD 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 35/128 (27%)
TPR repeat 452..491 CDD:276809 9/43 (21%)
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528 35/128 (27%)
TPR_11 215..>259 CDD:290150 11/43 (26%)
TPR_2 216..249 CDD:285020 11/32 (34%)
P4Hc 340..507 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.