DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4htm

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:308 Identity:65/308 - (21%)
Similarity:112/308 - (36%) Gaps:96/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGY-------SEDLQDHISTLNRYIDDRKS 70
            |...|||  ..:|.:.|..:.:..:.|     .|::|.       :|:.::.:|.:      |.|
  Rat   139 LSLKPLL--FEIPGFLSDEECRLIIHL-----AQMKGLQRSQILPTEEYEEAMSAM------RVS 190

  Fly    71 ELDKVGKDPEVYLGNPLNSFSLLHHLHFDWPAWRKLMEKPLAT------EYIT--EIQEMWSEM- 126
            :||               .|.||...|    ..|..:.:.||.      .::|  .||||:|.: 
  Rat   191 QLD---------------LFQLLDQNH----DGRLQLREVLAQTRLGNGRWMTPENIQEMYSAIK 236

  Fly   127 --PTKD------EYTNSIKAAKDFHKNETQGNFEFSPL--ESLQIALHAYDKKNYTE---AENWL 178
              |..|      |::|  ...:||||.......|.|.|  .|....||..:..::..   .:..|
  Rat   237 ADPDGDGVLSLQEFSN--MDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVL 299

  Fly   179 NITLNGYKNLSLQEKDLYEVLSPVIM--------------VYDETNGAAMIAKSYIRYFSNHQME 229
            .:|     .||.:..:|.|.|..|..              ||.||      ..|:.:..:|..:.
  Rat   300 RLT-----RLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPET------VCSHTKLVANESVP 353

  Fly   230 FIVMKSACILSVGLIIVYLS--YSNSENRHSLSKSKVINILK-IQENV 274
            |   :::|....  ::.||:  ....|....::.::..:.:. ||:||
  Rat   354 F---ETSCRYMT--VLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528 27/132 (20%)
P4Ha_N 260..389 CDD:285528 4/16 (25%)
TPR repeat 452..491 CDD:276809
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 18/80 (23%)
P4Hc 247..459 CDD:214780 35/168 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.