DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4HA3

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001275677.1 Gene:P4HA3 / 283208 HGNCID:30135 Length:604 Species:Homo sapiens


Alignment Length:340 Identity:79/340 - (23%)
Similarity:144/340 - (42%) Gaps:54/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 SKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYH---IQFERDKLAIASSPVASYSL 323
            :.|...|..:..::..|..|:...|.:|:       ||..::   :....|.....::|:.:::|
Human    35 TSVARALAPERRLLGLLRRYLRGEEARLR-------DLTRFYDKVLSLHEDSTTPVANPLLAFTL 92

  Fly   324 IHHMQSDWTHWQLFLQEDPGKDELASLM----SIKKYLPTKNDISEVCHGISKMLNAYLMTAQDI 384
            |..:||||.:....|:   ..:.:.:|.    .:::.||...|:......:.::.:.|::..:.:
Human    93 IKRLQSDWRNVVHSLE---ASENIRALKDGYEKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGL 154

  Fly   385 ANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLR--DCVALSDHSMEMKDYNKSKEWLNVAIS 447
            |.||.    .:...||:      .::...:.|.||.  ||..:...:.:|.||..:..||..|:|
Human   155 ARGVF----QRVTGSAI------TDLYSPKRLFSLTGDDCFQVGKVAYDMGDYYHAIPWLEEAVS 209

  Fly   448 MLESS-AYW--DPIVPSADLYLKLAEVYVKQQNWTLALE-TVEFALKS--NPRNAQLIRMQKRL- 505
            :...| ..|  :......|....||..|.:..|.:.||. :.||.|.|  |.|.|:.:...:|| 
Human   210 LFRGSYGEWKTEDEASLEDALDHLAFAYFRAGNVSCALSLSREFLLYSPDNKRMARNVLKYERLL 274

  Fly   506 ---SYHI----LLGPPKSPKLNIEN----------NDYRLRKNGSLYCFYDTKIRTFYSLLAPIK 553
               ..|:    ::..|..|.|...:          :...|.:..||||.|:|.... |.||.||:
Human   275 AESPNHVVAEAVIQRPNIPHLQTRDTYEGLCQTLGSQPTLYQIPSLYCSYETNSNA-YLLLQPIR 338

  Fly   554 AEVLFIDPLVILYHE 568
            .||:.::|.:.|||:
Human   339 KEVIHLEPYIALYHD 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 24/133 (18%)
TPR repeat 452..491 CDD:276809 12/42 (29%)
P4HA3NP_001275677.1 P4Ha_N 58..159 CDD:285528 20/110 (18%)
TPR_12 186..252 CDD:290160 16/65 (25%)
P4Hc 356..>478 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.