powered by:
Protein Alignment CG34041 and phy-3
DIOPT Version :9
Sequence 1: | NP_001034077.5 |
Gene: | CG34041 / 3885583 |
FlyBaseID: | FBgn0054041 |
Length: | 568 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507251.2 |
Gene: | phy-3 / 188624 |
WormBaseID: | WBGene00004026 |
Length: | 318 |
Species: | Caenorhabditis elegans |
Alignment Length: | 45 |
Identity: | 12/45 - (26%) |
Similarity: | 23/45 - (51%) |
Gaps: | 7/45 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 522 ENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILY 566
|..|.:.:||.|:...| .|::| |:..|::...|.:::|
Worm 60 ETKDTKWQKNDSICITY------VYNML-PVDMEIISWAPTLVIY 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10869 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.