DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4ha2

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_006532515.1 Gene:P4ha2 / 18452 MGIID:894286 Length:557 Species:Mus musculus


Alignment Length:369 Identity:71/369 - (19%)
Similarity:137/369 - (37%) Gaps:65/369 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LSVGLIIVYLSY----SNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDL 299
            |.|.::::.:|:    |..:.....|...:.:::..::::|:.|:.||...|.||..|......:
Mouse     3 LQVLVLVLLMSWFGVLSWVQAEFFTSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKM 67

  Fly   300 ATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDIS 364
            .....:...|.....:.||.:|.|:..:.:||......:.:|.....:|:|...:::.||..|.|
Mouse    68 EALTSRSAADPEGYLAHPVNAYKLVKRLNTDWPALGDLVLQDASAGFVANLSVQRQFFPTDEDES 132

  Fly   365 EVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHS 429
            .....:.::.:.|.:....|:.|.:.|  |||                 :.::|:.||..|...:
Mouse   133 GAARALMRLQDTYKLDPDTISRGELPG--TKY-----------------QAMLSVDDCFGLGRSA 178

  Fly   430 MEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTL-----ALETVEFAL 489
            ....||..:..|:...:..|::.       ..|.:...|...|:....:.|     |:|.....|
Mouse   179 YNEGDYYHTVLWMEQVLKQLDAG-------EEATVTKSLVLDYLSYAVFQLGDLHRAVELTRRLL 236

  Fly   490 KSNPRN----------AQLIRMQ--KRLSYHILLGPPKSPKLNIENNDY---------------- 526
            ..:|.:          .:|:..:  |.||.....|......|.....||                
Mouse   237 SLDPSHERAGGNLRYFERLLEEERGKSLSNQTDAGLATQENLYERPTDYLPERDVYESLCRGEGV 301

  Fly   527 RL--RKNGSLYCFYDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568
            :|  |:...|:|.|....|....|:||.|.|..:..|.::.|::
Mouse   302 KLTPRRQKKLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVRYYD 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 26/128 (20%)
TPR repeat 452..491 CDD:276809 7/43 (16%)
P4ha2XP_006532515.1 P4Ha_N 28..157 CDD:369820 26/128 (20%)
P4Hc 348..541 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.