DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and P4ha1

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_001303300.1 Gene:P4ha1 / 18451 MGIID:97463 Length:534 Species:Mus musculus


Alignment Length:346 Identity:68/346 - (19%)
Similarity:132/346 - (38%) Gaps:64/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 SKSKVINILKIQENVVKYLENYIYALETKLKTID------EALIDLATYHIQFERDKLAIASSPV 318
            |..::.:::..::::|..|::||.|.|.||:.|.      :.|...||      :|.......||
Mouse    24 SIGQMTDLIHNEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTAT------KDPEGFVGHPV 82

  Fly   319 ASYSLIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQD 383
            .::.|:..:.::|:..:..:.:|.....:::|...::|.|...|.......:.::.:.|.:....
Mouse    83 NAFKLMKRLNTEWSELENLILKDMSDGFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNT 147

  Fly   384 IANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAISM 448
            |:.|.:.|.|                   ::..::..||..|...:....||..::.|:..|::.
Mouse   148 ISKGNLPGVQ-------------------HKSFLTAEDCFELGKVAYTEADYYHTELWMEQALTQ 193

  Fly   449 LESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPR----NAQLIRMQKRLSYHI 509
            ||..........|...||..| || :|.:...||...:..|:.:|.    |..|:..:..:|...
Mouse   194 LEEGELSTVDKVSVLDYLSYA-VY-QQGDLDKALLLTKKLLELDPEHQRANGNLVYFEYIMSKEK 256

  Fly   510 LLG------------PPKSPKLNI----ENNDYRL-----------RKNGSLYCFYDTKIRTFYS 547
            ...            .||...:.:    |...|.:           |:...|:|.|....|....
Mouse   257 DANKSASGDQSDQKTAPKKKGIAVDYLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKF 321

  Fly   548 LLAPIKAEVLFIDPLVILYHE 568
            :|||.|.|..:..|.:|.:|:
Mouse   322 ILAPAKQEDEWDKPRIIRFHD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 26/134 (19%)
TPR repeat 452..491 CDD:276809 10/38 (26%)
P4ha1NP_001303300.1 P4Ha_N 24..153 CDD:285528 26/134 (19%)
TPR 205..238 11/34 (32%)
P4Hc 345..518 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.