Sequence 1: | NP_001034077.5 | Gene: | CG34041 / 3885583 | FlyBaseID: | FBgn0054041 | Length: | 568 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359861.1 | Gene: | C14E2.4 / 182616 | WormBaseID: | WBGene00015773 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 38/207 - (18%) |
---|---|---|---|
Similarity: | 84/207 - (40%) | Gaps: | 59/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 LDKVGKDPEVYLGN---PLNSFSLLHHLHFDW-PAWRKLMEKPLATEYITEIQEM------WS-- 124
Fly 125 -----EMPTKDEYTNSIKAAKDFHKNETQGNFEFSPLESLQIALHAYDKKNYTEAENWLNITLNG 184
Fly 185 YKNLSLQEKDLYEVLSPVIMVYDETNGAAMIAKSYIR--YFSNHQMEFIVMKSACILSVGLIIVY 247
Fly 248 LSYSNSE--NRH 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34041 | NP_001034077.5 | P4Ha_N | 29..138 | CDD:285528 | 14/82 (17%) |
P4Ha_N | 260..389 | CDD:285528 | |||
TPR repeat | 452..491 | CDD:276809 | |||
C14E2.4 | NP_001359861.1 | P4Hc | 100..276 | CDD:214780 | 25/134 (19%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10869 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |