DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and phy-2

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:NP_502317.1 Gene:phy-2 / 178170 WormBaseID:WBGene00004025 Length:539 Species:Caenorhabditis elegans


Alignment Length:382 Identity:76/382 - (19%)
Similarity:139/382 - (36%) Gaps:111/382 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 CILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLAT 301
            |:|: ||....|..:.::.:|.|...|         :|...::.||.|...:|.       ||..
 Worm     8 CLLA-GLAHADLFTAIADLQHMLGAEK---------DVTTIIDQYIEAERARLD-------DLRR 55

  Fly   302 Y-HIQFERDKLA------IASSPVASYSLIHHMQSDWTHWQLFLQEDPGKDELASL------MSI 353
            | |....|:..|      ..::|:.:|.||..:.::|...:..:..:.....|.::      ..:
 Worm    56 YAHEYVHRNAHAESVGPEFVTNPINAYLLIKRLTTEWKKVENIMLNNKASTFLKNITDNRVRSEV 120

  Fly   354 KKYLPTKNDISEVCHGISKMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMS 418
            |  .|.:.|:|.....:.::.:.|.:...|::||:|.|                 |.:.|:  :|
 Worm   121 K--FPGEEDLSGAATALLRLQDTYSLDTLDLSNGIIGG-----------------EKVSNK--LS 164

  Fly   419 LRDCVALSDHSMEMKDYNKSKEWLNVAISMLESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALE 483
            ..|...:...:...|||.....|:.||:..:|:..  .|.:...::...||....:|.|...||.
 Worm   165 GHDTFEVGRSAYNQKDYYHCLMWMQVALVKIENEN--PPTIEEWEILEYLAYSLYQQGNVRRALS 227

  Fly   484 TVEFALK---SNPRNAQLIR------------------MQKRLSYHILLG------------PPK 515
            ..:...|   ::||....::                  :.||:.|..::.            ||.
 Worm   228 LTKRLAKIAPNHPRAKGNVKWYEDMLQGKDMVGDLPPIVNKRVEYDGIVERDAYEALCRGEIPPV 292

  Fly   516 SPKLNIENNDYRLRKNGSLYCFYDTKIRTF------YSLLAPIKAEVLFIDPLVILY 566
            .||                   :..|:|.:      :..|||||.|:|..|||.:|:
 Worm   293 EPK-------------------WKNKLRCYLKRDKPFLKLAPIKVEILRFDPLAVLF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 26/141 (18%)
TPR repeat 452..491 CDD:276809 8/41 (20%)
phy-2NP_502317.1 P4Ha_N 21..154 CDD:285528 28/150 (19%)
TPR_16 169..240 CDD:290168 15/72 (21%)
P4Hc 335..508 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.