DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34041 and p4ha1

DIOPT Version :9

Sequence 1:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster
Sequence 2:XP_031761963.1 Gene:p4ha1 / 100490484 XenbaseID:XB-GENE-987760 Length:526 Species:Xenopus tropicalis


Alignment Length:341 Identity:74/341 - (21%)
Similarity:135/341 - (39%) Gaps:69/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 VINILKIQENVVKYLENYIYALETKLKTID------EALIDLATYHIQFERDKLAIASSPVASYS 322
            :|::|..::::|..|::||.|.|.||..|.      :.|.|.||      :|.......||.::.
 Frog    27 MIDLLNTEKDLVTSLKDYIKAEEQKLAQIKKWADKLDHLTDTAT------KDPEGYLGHPVNAFK 85

  Fly   323 LIHHMQSDWTHWQLFLQEDPGKDELASLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANG 387
            |:..:.::|...:..:.:|.....:::|...::|.|...|.:.....:.::.:.|.:....|:.|
 Frog    86 LMKRLNTEWVKLENLILKDISDGFISNLTIQRQYFPNDEDQTGAAKALLRLQDTYNLDTDTISKG 150

  Fly   388 VILGTQTKYISSALKLEYLYMEIICNRHLMSL--RDCVALSDHSMEMKDYNKSKEWLNVAISML- 449
            .:.|.                     :|..||  .||..|...:....||..::.|:..|:|.| 
 Frog   151 NLPGV---------------------KHKTSLTAEDCFDLGKTAYTDADYYHTELWMEQALSQLD 194

  Fly   450 ---ESSAYWDPIVPSADLYLKLAEVYVKQQNWTLALETVEFALKSNPR----NAQLIRMQKRLSY 507
               |||.  |.::...  ||..| || :|.:...||...:.:|:.:|.    |..|..:..:.|.
 Frog   195 AGEESSL--DKVMVLD--YLSYA-VY-QQGDLDKALTLTKRSLELDPEHQRGNGNLRHIMSKESN 253

  Fly   508 HILLGPPKS---------PKLNIENNDYR-----------LRKNGSLYCFYDTKIRTFYSLLAPI 552
            .....|.:.         ||.::|...|.           .|:...|:|.|....:....:|:|.
 Frog   254 KSSSSPSEGAELRTRKGRPKDHLEKEKYEKLCRGEGVKMTSRRQKRLFCRYFDGKKDPLLILSPT 318

  Fly   553 KAEVLFIDPLVILYHE 568
            |.|..:..|.::.||:
 Frog   319 KQEDEWDKPRIVRYHD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 28/130 (22%)
TPR repeat 452..491 CDD:276809 11/38 (29%)
p4ha1XP_031761963.1 P4Ha_N 24..111 CDD:400573 21/89 (24%)
P4Hc 337..510 CDD:214780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.