DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42821 and CG42822

DIOPT Version :9

Sequence 1:NP_001034060.2 Gene:CG42821 / 3885579 FlyBaseID:FBgn0262003 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001189243.1 Gene:CG42822 / 10178916 FlyBaseID:FBgn0262004 Length:112 Species:Drosophila melanogaster


Alignment Length:110 Identity:81/110 - (73%)
Similarity:89/110 - (80%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FSL--CLLLGLALSQVSASCPESCPDTEDVVWALGGGCNVFRNKCYFDKANCNPDYELTITTKEE 67
            |||  ||||.:|||||..:|...|||||:||||||||||||||||||||.||:....||||||.|
  Fly     3 FSLYICLLLCVALSQVRGNCSGECPDTEEVVWALGGGCNVFRNKCYFDKENCHRKPALTITTKRE 67

  Fly    68 CQKLCADACPAVYQPTGGIYKGQVRNFGNECEKIIHTCRTGETFV 112
            |||.|||.|.|:||||.|||||:|.||||||||..||||||:||:
  Fly    68 CQKQCADICTAIYQPTTGIYKGEVLNFGNECEKRAHTCRTGQTFL 112



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442598
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7IK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.