DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42821 and CG42822

DIOPT Version :10

Sequence 1:NP_001034060.2 Gene:CG42821 / 3885579 FlyBaseID:FBgn0262003 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001189243.1 Gene:CG42822 / 10178916 FlyBaseID:FBgn0262004 Length:112 Species:Drosophila melanogaster


Alignment Length:110 Identity:81/110 - (73%)
Similarity:89/110 - (80%) Gaps:2/110 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FSL--CLLLGLALSQVSASCPESCPDTEDVVWALGGGCNVFRNKCYFDKANCNPDYELTITTKEE 67
            |||  ||||.:|||||..:|...|||||:||||||||||||||||||||.||:....||||||.|
  Fly     3 FSLYICLLLCVALSQVRGNCSGECPDTEEVVWALGGGCNVFRNKCYFDKENCHRKPALTITTKRE 67

  Fly    68 CQKLCADACPAVYQPTGGIYKGQVRNFGNECEKIIHTCRTGETFV 112
            |||.|||.|.|:||||.|||||:|.||||||||..||||||:||:
  Fly    68 CQKQCADICTAIYQPTTGIYKGEVLNFGNECEKRAHTCRTGQTFL 112

Return to query results.
Submit another query.