DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34008 and CG14346

DIOPT Version :9

Sequence 1:NP_001034062.1 Gene:CG34008 / 3885577 FlyBaseID:FBgn0054008 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001285561.1 Gene:CG14346 / 33325 FlyBaseID:FBgn0031337 Length:206 Species:Drosophila melanogaster


Alignment Length:197 Identity:56/197 - (28%)
Similarity:90/197 - (45%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLNDIGQP--LILEKGKVYSSYEEHRGPLLFTSAALGDLIAPQNWCQLAVGSQ--LDISRLQSH 61
            |||:|.|.|  :..|....| :|:.| |..|.|||.. ::..|..|......::  ||..:.:.:
  Fly     1 MFLDDFGNPKEVTPETLSTY-TYDLH-GTKLLTSADT-EIYLPPMWHGTIYSTEKLLDTYKRRFN 62

  Fly    62 ADVSESCTFEILLPNKPTRLVYDENEITITLIPAGRK-ENGLECNLFYIEN--GHARYLIVDCLS 123
            .|.: ..||..:.|.:|..:......|.:||:|||:. .:..:..:|.|:.  .....|:...||
  Fly    63 PDPT-LLTFHAMQPYEPEFICVQRTVIELTLLPAGQSLYSDKDIVVFLIKQPAEMKNSLVTKELS 126

  Fly   124 GYLDFLPKASGSLHTGLCQGIDVLYVDEELLAENQIN------EDLYSLVDLIRPKFIYGLRQWE 182
            ..|||.|.........:.:||||:|||:::.  |.|:      ..||:|:..|:|..:..|....
  Fly   127 TLLDFFPHNHHYHSIIMNEGIDVVYVDDKIY--NNISPTSHQFHRLYNLLRNIQPDDVQSLSGSP 189

  Fly   183 LP 184
            ||
  Fly   190 LP 191



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7QQ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019703
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.