DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34008 and C56G2.5

DIOPT Version :9

Sequence 1:NP_001034062.1 Gene:CG34008 / 3885577 FlyBaseID:FBgn0054008 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_498384.2 Gene:C56G2.5 / 183867 WormBaseID:WBGene00016980 Length:713 Species:Caenorhabditis elegans


Alignment Length:109 Identity:26/109 - (23%)
Similarity:43/109 - (39%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CTFEILLPNKPTRLVYDENEITITLIPAGRKENGLECNLFYIENGHARYLIVDCLSGYLDFLPKA 132
            |..:|:..:..|| .:|..|:.|..:    ..:...|:|.      |.::..|.|...|:|.  .
 Worm   436 CAIKIIEKDPRTR-SFDTPELHILKV----LHHPFICSLI------ASFIEKDALYLVLEFC--E 487

  Fly   133 SGSLHT-------GLCQGIDVLYVDEELLAENQINEDLYSLVDL 169
            :|.|||       |..:.....:....:||...::|.||...||
 Worm   488 AGDLHTHLSRTAHGFTKKQVTFFAASIVLAVEYLHEKLYCHRDL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34008NP_001034062.1 None
C56G2.5NP_498384.2 S_TKc 410..655 CDD:214567 26/109 (24%)
PKc_like 416..655 CDD:304357 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.